CWC15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84735

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CWC15 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CWC15. Peptide sequence: IKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CWC15 Antibody - BSA Free

Western Blot: CWC15 Antibody [NBP2-84735]

Western Blot: CWC15 Antibody [NBP2-84735]

Western Blot: CWC15 Antibody [NBP2-84735] - Host: Rabbit. Target Name: CWC15. Sample Tissue: Human THP-1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for CWC15 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CWC15

CWC15, or Spliceosome-associated protein CWC15 homolog, consists of a 229 amino acid isoform that is 27 kDa, and is involved in stimulating pre-mRNA splicing during transcription. Current research is being conducted on CWC15 and its relation to a variety of diseases and disorders, including inclusion conjunctivitis, ADHD, conduct disorder, and laryngotracheitis. CWC15 has been linked to the mRNA splicing pathway, and it interacts with proteins such as CTNNBL1, CCT5, CDC5L, RBM17, and ARHGAP17.

Alternate Names

C11orf5ORF5, CWC15 homolog, CWC15 homolog (S. cerevisiae), CWC15 spliceosome-associated protein homolog (S. cerevisiae), Cwf15, HSPC148, protein CWC15 homolog

Gene Symbol

CWC15

Additional CWC15 Products

Product Documents for CWC15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CWC15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CWC15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CWC15 Antibody - BSA Free and earn rewards!

Have you used CWC15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies