Cyclophilin A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-46850

Novus Biologicals
Discontinued Product
NBP2-46850 has been discontinued. View all Cyclophilin A products.

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FGKVKERVNIVEAMEHFGYRNSKTSKKITIADCG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cyclophilin A Antibody - BSA Free

Immunohistochemistry: Cyclophilin A Antibody [NBP2-46850]

Immunohistochemistry: Cyclophilin A Antibody [NBP2-46850]

Immunohistochemistry: Cyclophilin A Antibody [NBP2-46850] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Applications for Cyclophilin A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cyclophilin A

Cyclophilin A, also known as Peptidylprolyl Isomerase A, PPIA, CYPA, and CYPH, was originally characterized for its ability to catalyze the transition between cis and trans proline residues critical for proper folding of proteins. Ubiquitously expressed, Cyclophilin A has a predicted molecular weight of 17 kDa and is proinflammatory cytokine that is secreted in response to inflammatory stimuli. Human Cyclophilin A shares 95% amino acid identity with both the mouse and rat orthologs. Cyclophilin A is the main target of the immunosuppressive drug Cyclosporin A. The immunosuppressive activity of cyclosporins has been correlated with their ability to form complexes with cyclophilins that inhibit Calcineurin Phosphatase activity and prevent incorporation of Cyclophilin A into viral particles. Cyclophilin A is known to be incorporated into many viruses, including HIV1 and Hepatitis C, where it may be involved in functions such as viral assembly, replication, and infectivity. In addition, Cyclophilin A has been shown to promote atherosclerosis via binding to Extracellular matrix metalloproteinase (MMP) inducer (EMMPRIN) on CD34+ progenitor cells and stimulating differentiation to foam cells, an essential step during atherosclerotic plaque formation in blood vessels. Cyclophilin A-induced disruption of blood-brain barrier function is thought to contribute to the increased risk of developing Alzheimer’s disease in individuals that possess one or two Apolipoprotein E4 alleles.

Alternate Names

CYPA, CYPH, PPIA, Rotamase

Entrez Gene IDs

5478 (Human)

Gene Symbol

PPIA

UniProt

Additional Cyclophilin A Products

Product Documents for Cyclophilin A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cyclophilin A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cyclophilin A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cyclophilin A Antibody - BSA Free and earn rewards!

Have you used Cyclophilin A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...