CYP2F1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83986

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CYP2F1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CYP2F1. Peptide sequence: ILLLLLALVCLLLTLSSRDKGKLPPGPRPLSILGNLLLLCSQDMLTSLTK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CYP2F1 Antibody - BSA Free

Western Blot: CYP2F1 Antibody [NBP2-83986]

Western Blot: CYP2F1 Antibody [NBP2-83986]

Western Blot: CYP2F1 Antibody [NBP2-83986] - Host: Rabbit. Target Name: CP2F1. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml

Applications for CYP2F1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CYP2F1

CYP2F1, or Cytochrome P450 2F1, consists of a 491 amino acid isoform that is 56 kDa, and is involved in drug metabolism, cholesterol, steroid, and lipid synthesis, and the dealkylation of pentoxyresorufin, ethoxycoumarin, and propoxycoumarin. Current research is being conducted with CYP2F1 and a variety of diseases and disorders, including ovarian cancer, metastasis, cholesterol, vaccinia, and colorectal cancer, to determine the relationship between the protein and the disease. CYP2F1 interacts with ADH1A, ADH1B, ALDH1A3, EPHX1, and GSTA1 in biological processes such as metapathway biotransformation, biological oxidations, and CYP2E1 reactions.

Alternate Names

C2F1, CYP2F, CYPIIF1, cytochrome P450 2F1, cytochrome P450, family 2, subfamily F, polypeptide 1, cytochrome P450, subfamily IIF, polypeptide 1, EC 1.14.14.1, flavoprotein-linked monooxygenase, MGC126121, microsomal monooxygenase, xenobiotic monooxygenase

Gene Symbol

CYP2F1

Additional CYP2F1 Products

Product Documents for CYP2F1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CYP2F1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYP2F1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CYP2F1 Antibody - BSA Free and earn rewards!

Have you used CYP2F1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies