DBF4B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87247

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DBF4B. Peptide sequence: MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DBF4B Antibody - BSA Free

Western Blot: DBF4B Antibody [NBP2-87247]

Western Blot: DBF4B Antibody [NBP2-87247]

Western Blot: DBF4B Antibody [NBP2-87247] - Host: Rabbit. Target Name: DBF4B. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: DBF4B Antibody [NBP2-87247]

Western Blot: DBF4B Antibody [NBP2-87247]

Western Blot: DBF4B Antibody [NBP2-87247] - Host: Rabbit. Target: DBF4B. Positive control (+): 293T Cell Lysate (2T). Negative control (-): HepG2 Cell Lysate (HG). Antibody concentration: 1ug/ml

Applications for DBF4B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DBF4B

DBF4B, also known as Protein DBF4 homolog B, consists of four isoforms of sizes 67.2 kDa, 47.2 kDa, 54.7 kDa, and 18.4 kDa and is involved in DNA replication and cellular generation by stimulating kinase activity. The protein has not been researched in association with any diseases. The protein interacts with PTEN, APC, CDC7, MDFI, and KRTAP4-12 proteins during the early S phase of cell cycle DNA replication.

Alternate Names

Activator of S phase kinase-like protein 1, activator of S-phase kinase-like protein 1, ASKL1CHIFB, ASK-like protein 1, chifb, Chiffon homolog B, DBF4 homolog B (S. cerevisiae), Dbf4-related factor 1, DRF1MGC15009, FLJ13087, protein DBF4 homolog B, ZDBF1B, zinc finger, DBF-type containing 1B

Gene Symbol

DBF4B

Additional DBF4B Products

Product Documents for DBF4B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DBF4B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DBF4B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DBF4B Antibody - BSA Free and earn rewards!

Have you used DBF4B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...