DDX10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87258

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DDX10 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DDX10. Peptide sequence: EANKRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DDX10 Antibody - BSA Free

Western Blot: DDX10 Antibody [NBP2-87258]

Western Blot: DDX10 Antibody [NBP2-87258]

Western Blot: DDX10 Antibody [NBP2-87258] - Host: Rabbit. Target Name: DDX10. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for DDX10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDX10

DDX10, also known as Probable ATP-dependent RNA helicase DDX10, is a 100.9 kDa 875 amino acid protein that unwinds RNA as a part of the DEAD box protein family. This protein is being researched for its connection to diseases and disorders such as leukemia, malaria, and myelodysplastic syndrome. Little is known about the proteins interactions with other proteins and pathways.

Alternate Names

DDX10-NUP98 fusion protein type 2, DEAD (Asp-Glu-Ala-Asp) box polypeptide 10, DEAD box protein 10, DEAD box-10, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 10 (RNA helicase), EC 3.6.1, EC 3.6.4.13, HRH-J8, probable ATP-dependent RNA helicase DDX10

Gene Symbol

DDX10

Additional DDX10 Products

Product Documents for DDX10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DDX10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX10 Antibody - BSA Free and earn rewards!

Have you used DDX10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies