DEC2/SHARP1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-58737PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all DEC2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DEC2/SHARP1.

Source: E. coli

Amino Acid Sequence: PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58737.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-58737PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DEC2

Human DEC1 is a 412 amino acid, basic helix-loop-helix (bHLH) containing protein that is involved in the control of proliferation and/or differentiation of several cell types including nerve cells, fibroblasts and chondrocytes. The bHLH region of DEC1 is structurally similar to the bHLH regions of the mammalian HES family, Drosophila hairy, and Enhancer of split m7. DEC1 is a novel direct target for cAMP in a wide range of cells, and is involved in the control of gene expression in cAMP-activated cells. DEC2, also known as SHARP1, is highly expressed in skeletal muscle and brain. The gene encoding human DEC2 maps to chromosome 12p11.23-p12.1. DEC1 and DEC2 play a role in regulating the mammalian molecular clock by suppressing the transcription of specific clock genes. Both DEC1 and DEC2 are detected in the suprachiasmimc nucleus in a circadian fashion. Brief light impulses induce the expression of DEC1 in a phase-dependent manner.

Long Name

Differentially expressed in chondrocytes protein 2

Alternate Names

BHLHB3, BHLHE41, SHARP-1

Gene Symbol

BHLHE41

Additional DEC2 Products

Product Documents for DEC2/SHARP1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DEC2/SHARP1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for DEC2/SHARP1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review DEC2/SHARP1 Recombinant Protein Antigen and earn rewards!

Have you used DEC2/SHARP1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes

Associated Pathways

Th2 Differentiation Pathway Th2 Differentiation Pathway Thumbnail