DGCR6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84005

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DGCR6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DGCR6. Peptide sequence: VFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DGCR6 Antibody - BSA Free

Western Blot: DGCR6 Antibody [NBP2-84005]

Western Blot: DGCR6 Antibody [NBP2-84005]

Western Blot: DGCR6 Antibody [NBP2-84005] - Host: Rabbit. Target Name: DGCR6. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for DGCR6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DGCR6

DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia. [provided by RefSeq]

Alternate Names

DiGeorge syndrome critical region 6, DiGeorge syndrome critical region gene 6, DiGeorge syndrome critical region protein 6, protein DGCR6

Gene Symbol

DGCR6

Additional DGCR6 Products

Product Documents for DGCR6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DGCR6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DGCR6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DGCR6 Antibody - BSA Free and earn rewards!

Have you used DGCR6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies