DGCR6L Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79875

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DGCR6L Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human DGCR6LThe immunogen for this antibody is DGCR6L. Peptide sequence QQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DGCR6L Antibody - BSA Free

Western Blot: DGCR6L Antibody [NBP1-79875]

Western Blot: DGCR6L Antibody [NBP1-79875]

Western Blot: DGCR6L Antibody [NBP1-79875] - Human Fetal Brain Lysate 1ug/ml Gel Concentration 12%

Applications for DGCR6L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DGCR6L

DGCR6L, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. [provided by RefSeq]

Alternate Names

DiGeorge syndrome critical region 6-like protein, DiGeorge syndrome critical region gene 6 like, DiGeorge syndrome critical region gene 6-like, FLJ10666, protein DGCR6L

Gene Symbol

DGCR6L

UniProt

NP_150282 (Human)

Additional DGCR6L Products

Product Documents for DGCR6L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DGCR6L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DGCR6L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DGCR6L Antibody - BSA Free and earn rewards!

Have you used DGCR6L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies