![Western Blot: DIO3 Antibody [NBP2-86616]](https://resources.rndsystems.com/images/products/DIO3-Antibody-Western-Blot-NBP2-86616-img0001.jpg "Western Blot: DIO3 Antibody [NBP2-86616]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DIO3. Peptide sequence: EVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for DIO3 Antibody - BSA Free
Western Blot: DIO3 Antibody [NBP2-86616]
Western Blot: DIO3 Antibody [NBP2-86616] - Host: Rabbit. Target Name: DIO3. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1.0ug/mlApplications for DIO3 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: DIO3
Dio3 has an essential role for regulation of thyroid hormone inactivation during embryological development, and may play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Dio3 has been linked to the development of consumptive hypothyroidism in both infants and adults.
DIO3 antibodies are useful tools for hormone regulation research and in some embryological development studies.
Alternate Names
5DIII, D3, deiodinase, iodothyronine, type III, DIOIII, EC 1.97.1, EC 1.97.1.11, ITDI3, placental type, thyroxine deiodinase type III (selenoprotein), Type 3 DI, type 3 iodothyronine selenodeiodinase, type III iodothyronine deiodinase, type-III 5' deiodinase, Type-III 5'-deiodinase
Gene Symbol
DIO3
Additional DIO3 Products
Product Documents for DIO3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for DIO3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for DIO3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review DIO3 Antibody - BSA Free and earn rewards!
Have you used DIO3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for DIO3 Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: I am looking for a Dio3 peptide that I can inject in vivo to produce a biological effect. Can you provide information or confirm whether the Dio3 peptide you have would be effective as a biological agent in vivo?
A: I have pulled up information on the Dio3 peptides and recombinant proteins that we have available. Unfortunately I would not expect any of them to be biologically active and capable of producing a response when injected in vivo. The two peptides we carry are simply intended to be used for negative control competition assays to block signal of the primary and determine what is specific and non-specific as far as signal is concerned. The other two recombinant proteins are ones we distribute for a Taiwanese company called Abnova and they should not be biologically active based on the cell free wheat germ system employed to synthesize them. We will typically list our active proteins with an indication of such on our datasheet if it has been tested and usually the application of functional listed.
Loading...