DMRT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10424

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_056641). Peptide sequence VFSPPSSQDSGLVSLSSSSPMSNESSKGVLECESASSEPSSYAVNQVLEE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DMRT1 Antibody - BSA Free

Western Blot: DMRT1 Antibody [NBP3-10424]

Western Blot: DMRT1 Antibody [NBP3-10424]

Western Blot: DMRT1 Antibody [NBP3-10424] - Western blot analysis of DMRT1 in NIH/3T3 cell lysate as a positive control. Antibody dilution at 0.2-1 ug/ml

Applications for DMRT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DMRT1

DMRT1 is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous.

Alternate Names

DM domain expressed in testis 1, DMT1DM domain expressed in testis protein 1, doublesex and mab-3 related transcription factor 1, doublesex- and mab-3-related transcription factor 1

Gene Symbol

DMRT1

Additional DMRT1 Products

Product Documents for DMRT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DMRT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DMRT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DMRT1 Antibody - BSA Free and earn rewards!

Have you used DMRT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...