DPH4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56748

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DPH4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DPH4 The peptide sequence was selected from the N terminal of DPH4. Peptide sequence MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DPH4 Antibody - BSA Free

Western Blot: DPH4 Antibody [NBP1-56748]

Western Blot: DPH4 Antibody [NBP1-56748]

Western Blot: DPH4 Antibody [NBP1-56748] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Applications for DPH4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DPH4

Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 CD685768.1 19-28 11-652 AL833128.1 1-642 653-3000 AC108456.7 42515-44862

Alternate Names

CSL-type zinc finger-containing protein 3, DnaJ (Hsp40) homolog, subfamily C, member 24, dnaJ homolog subfamily C member 24, DPH4 homolog, DPH4, JJJ3 homolog, DPH4, JJJ3 homolog (S. cerevisiae), DPH41700030A21Rik, JJJ3, S. cerevisiae), ZCSL3, zinc finger, CSL domain containing 3, zinc finger, CSL-type containing 3

Gene Symbol

DNAJC24

UniProt

Q6P3W2 (Human)

Additional DPH4 Products

Product Documents for DPH4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DPH4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DPH4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DPH4 Antibody - BSA Free and earn rewards!

Have you used DPH4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies