DPH4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87968

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DPH4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHY

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DPH4 Antibody - BSA Free

Immunohistochemistry-Paraffin: DPH4 Antibody [NBP1-87968]

Immunohistochemistry-Paraffin: DPH4 Antibody [NBP1-87968]

Immunohistochemistry-Paraffin: DPH4 Antibody [NBP1-87968] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
DPH4 Antibody - BSA Free Western Blot: DPH4 Antibody - BSA Free [NBP1-87968]

Western Blot: DPH4 Antibody - BSA Free [NBP1-87968]

Analysis in control (vector only transfected HEK293T lysate) and DNAJC24 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for DPH4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DPH4

Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylationand inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved insynthesis of diphthamide in EEF2 (Liu et al., 2004 (PubMed 15485916)).(supplied by OMIM)

Alternate Names

CSL-type zinc finger-containing protein 3, DnaJ (Hsp40) homolog, subfamily C, member 24, dnaJ homolog subfamily C member 24, DPH4 homolog, DPH4, JJJ3 homolog, DPH4, JJJ3 homolog (S. cerevisiae), DPH41700030A21Rik, JJJ3, S. cerevisiae), ZCSL3, zinc finger, CSL domain containing 3, zinc finger, CSL-type containing 3

Gene Symbol

DNAJC24

Additional DPH4 Products

Product Documents for DPH4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DPH4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DPH4 Antibody - BSA Free

Customer Reviews for DPH4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DPH4 Antibody - BSA Free and earn rewards!

Have you used DPH4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies