DPRX Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82918

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DPRX Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DPRX. Peptide sequence: KEMASKIDIHPTVLQVWFKNHRAKLKKAKCKHIHQKQETPQPPIPEGGVS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DPRX Antibody - BSA Free

Western Blot: DPRX Antibody [NBP2-82918]

Western Blot: DPRX Antibody [NBP2-82918]

Western Blot: DPRX Antibody [NBP2-82918] - Host: Rabbit. Target Name: DPRX. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for DPRX Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DPRX

Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development.Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is amember of the DPRX homeobox gene family. Evidence of mRNA expression has not yet been found for this gene. Multiple,related processed pseudogenes have been found which are thought to reflect expression of this gene in the germ line orembryonic cells. (provided by RefSeq)

Alternate Names

divergent paired-related homeobox, divergent-paired related homeobox

Gene Symbol

DPRX

Additional DPRX Products

Product Documents for DPRX Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DPRX Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DPRX Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DPRX Antibody - BSA Free and earn rewards!

Have you used DPRX Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies