DUOX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87306

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human DUOX1. Peptide sequence: LLVGAWTPLGAQNPISWEVQRFDGWYNNLMEHRWGSKGSRLQRLVPASYA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DUOX1 Antibody - BSA Free

Western Blot: DUOX1 Antibody [NBP2-87306]

Western Blot: DUOX1 Antibody [NBP2-87306]

Western Blot: DUOX1 Antibody [NBP2-87306] - Host: Rabbit. Target Name: DUOX1. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for DUOX1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DUOX1

The DUOX1 gene encodes a glycoprotein dual oxidase 1 protein with an isoform 1 of 1,551 amino acids long at 177 kDA and an isoform 2 at 1,197 amino acids long at 137 kDA. This protein is called a dual oxidase because it obtains a peroxidase homology domain and a gp91phox domain. DUOX1 generates hydrogen peroxide which is essential for thyroid peroxidase/TPO and lactoperoxidase/LPO, as well as lactoperoxidase-mediated antimicrobial defense. DUOX1 interacts with genes TXNDC11 and TPO and has been investigated for its role in various diseases such as thyroiditis, lung cancer, alcoholism, carcinoma, chronic obstructive pulmonary disease, hypothyroidism, hepatitis, prostatitis, and chronic granulomatous disease.

Alternate Names

dual oxidase 1, DUOX, EC 1.11.1.-, EC 1.6.3.1, Large NOX 1, LNOX1flavoprotein NADPH oxidase, Long NOX 1, MGC138840, NADPH thyroid oxidase 1, nicotinamide adenine dinucleotide phosphate oxidase, NOXEF1, THOX1MGC138841, Thyroid oxidase 1

Gene Symbol

DUOX1

Additional DUOX1 Products

Product Documents for DUOX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DUOX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DUOX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DUOX1 Antibody - BSA Free and earn rewards!

Have you used DUOX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...