DXO Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87313

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DXO Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of DXO. Peptide sequence: RDGYPDRYQPRDEEVRERLDHLLRWVLEHRNQLEGGPGWLAGATVTWRGH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DXO Antibody - BSA Free

Western Blot: DXO Antibody [NBP2-87313]

Western Blot: DXO Antibody [NBP2-87313]

Western Blot: DXO Antibody [NBP2-87313] - WB Suggested Anti-Dom3z Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Liver

Applications for DXO Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DXO

This gene localizes to the major histocompatibility complex class III (MHC III) region on chromosome 6. The function of its protein product is unknown, but its ubiquitous expression and conservation in both simple and complex eukaryotes suggests that this may be a housekeeping gene.

Alternate Names

DOM-3 (C. elegans) homolog Z, Dom-3 homolog Z, dom-3 homolog Z (C. elegans), DOM3L, DOM3Z, NG6, protein Dom3Z, RAI1

Gene Symbol

DXO

Additional DXO Products

Product Documents for DXO Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DXO Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DXO Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DXO Antibody - BSA Free and earn rewards!

Have you used DXO Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies