E2F5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82955

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human E2F5. Peptide sequence: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for E2F5 Antibody - BSA Free

Western Blot: E2F5 Antibody [NBP2-82955]

Western Blot: E2F5 Antibody [NBP2-82955]

Western Blot: E2F5 Antibody [NBP2-82955] - WB Suggested Anti-E2F5 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate
Western Blot: E2F5 Antibody [NBP2-82955]

Western Blot: E2F5 Antibody [NBP2-82955]

Western Blot: E2F5 Antibody [NBP2-82955] - Host: Rabbit. Target Name: E2F5. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1ug/ml

Applications for E2F5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: E2F5

The protein encoded by the E2F5 gene is a member of the E2F family of transcription factors. The E2F family plays a crucialrole in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transformingproteins of small DNA tumor viruses. The E2F proteins contain several evolutionarily conserved domains that arepresent in most members of the family. These domains include a DNA binding domain, a dimerization domain whichdetermines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domainenriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within thetransactivation domain. This protein is differentially phosphorylated and is expressed in a wide variety of humantissues. It has higher identity to E2F4 than to other family members. Both this protein and E2F4 interact with tumorsuppressor proteins p130 and p107, but not with pRB. Alternative splicing results in multiple variants encodingdifferent isoforms. (provided by RefSeq)

Alternate Names

E2F transcription factor 5, p130-binding, E2F-5, transcription factor E2F5

Gene Symbol

E2F5

Additional E2F5 Products

Product Documents for E2F5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for E2F5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for E2F5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review E2F5 Antibody - BSA Free and earn rewards!

Have you used E2F5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...