Catalog Number: 3202
Biological Activity
Potent irreversible αVβ3 integrin antagonist (Ki = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC50 = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, αIIbβ3) receptors (IC50 = 30 nM) in vitro.
Technical Data
  • M.Wt:
    5417.1
  • Formula:
    C217H341N71O74S9
  • Sequence:
    ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

    (Modifications: Disulfide bridge between 2 - 11, 7 - 32, 8 - 37, 20 - 39)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    154303-05-6
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins RGD-containing peptides from viper venoms.
    Musial et al.
    Circulation, 1990;82:261
  2. Echistatin is a potent inhibitor of bone resorption in culture.
    Sato et al.
    J.Cell.Biol., 1990;111:1713
  3. Biochemical characteriation of the binding of echistatin to integrin αVβ3 receptor.
    Kumar et al.
    J.Pharmacol.Exp.Ther., 1997;283:843
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Echistatin, α1 isoform include:

2 Citations: Showing 1 - 2
Filter your results:

  1. Angiopoietin-like 3 induces podocyte F-actin rearrangement through integrin α(V)β3/FAK/PI3K pathway-mediated Rac1 activation.
    Authors: Lin Et al.
    PLoS One 2013;2013:135608
  2. Matrix stiffness modulates proliferation, chemotherapeutic response, and dormancy in hepatocellular carcinoma cells.
    Authors: Schrader Et al.
    Biomed Res Int 2011;53:1192

Have you used Echistatin, α1 isoform?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information