ECSIT Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87320

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ECSIT Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse ECSIT. Peptide sequence: EPWLVPRPPEPQRKPIKVPAMHEDSFKPSGNRERDKASFLNAVRSFGAHN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ECSIT Antibody - BSA Free

Western Blot: ECSIT Antibody [NBP2-87320]

Western Blot: ECSIT Antibody [NBP2-87320]

Western Blot: ECSIT Antibody [NBP2-87320] - WB Suggested Anti-Ecsit Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Heart

Applications for ECSIT Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ECSIT

Activation of NF-kB as a result of Toll-like receptor (TLR) and IL-1 receptor signaling is a major component of innate immune responses (reviewed in 1). Signals from these receptors are relayed by a number of adapter molecules such as TRIF, TIRAP, and MyD88 (2) to kinases such as IRAK (3) and other intermediates such as TNF receptor associated factor (TRAF)-6 (4). ECSIT (evolutionarily conserved signaling intermediate in Toll pathways) was initially identified as a cytoplasmic protein interacting specifically with TNF receptor associated factor (TRAF)-6 in the TLR pathway (5). Recently however, ECSIT has also been shown to be required for bone morphogenetic protein (Bmp) signaling and mesoderm formation during mouse embryogenesis (6), indicating the possibility of cross-talk between the TLR/IL-B and Bmp signaling pathways.

Alternate Names

ECSIT homolog (Drosophila), evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial, likely ortholog of mouse signaling intermediate in Toll pathway evolutionarilyconserved, Protein SITPEC, signaling intermediate in Toll pathway evolutionarily conserved ortholog, SITPECsignaling intermediate in Toll pathway, evolutionarily conserved

Gene Symbol

ECSIT

Additional ECSIT Products

Product Documents for ECSIT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ECSIT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ECSIT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ECSIT Antibody - BSA Free and earn rewards!

Have you used ECSIT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies