ELL2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04899

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all ELL2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 200-292 of human ELL2 (NP_036213.2). TISQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ELL2 Antibody - Azide and BSA Free

ELL2 Antibody - Azide and BSA Free

Western Blot: ELL2 Antibody - Azide and BSA Free [ELL2] -

Western Blot: ELL2 Antibody - Azide and BSA Free [ELL2] - Western blot analysis of lysates from Rat testis, using ELL2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for ELL2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ELL2

ELL2 - elongation factor, RNA polymerase II, 2

Alternate Names

ELL-related RNA polymerase II, elongation factor, elongation factor, RNA polymerase II, 2, RNA polymerase II elongation factor ELL2

Gene Symbol

ELL2

Additional ELL2 Products

Product Documents for ELL2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ELL2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ELL2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ELL2 Antibody - Azide and BSA Free and earn rewards!

Have you used ELL2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies