ELMO3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87354

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ELMO3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELMO3. Peptide sequence: TLALKPTSLELFRTKVNALTYGEVLRLRQTERLHQEGTLAPPILELREKL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ELMO3 Antibody - BSA Free

Western Blot: ELMO3 Antibody [NBP2-87354]

Western Blot: ELMO3 Antibody [NBP2-87354]

Western Blot: ELMO3 Antibody [NBP2-87354] - Host: Rabbit. Target Name: ELMO3. Sample Type: Liver tumor lysates. Antibody Dilution: 1.0ug/ml

Applications for ELMO3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ELMO3

ELMO3 is encoded by this gene is similar to a C. elegans protein that functions in phagocytosis of apoptotic cells and in cell migration. Other members of this small family of engulfment and cell motility (ELMO) proteins have been shown to interact with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes.

Alternate Names

CED12, CED-12, ced-12 homolog 3, ELMO-3, engulfment and cell motility 3, engulfment and cell motility 3 (ced-12 homolog, C. elegans), engulfment and cell motility protein 3, FLJ13824

Gene Symbol

ELMO3

Additional ELMO3 Products

Product Documents for ELMO3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ELMO3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ELMO3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ELMO3 Antibody - BSA Free and earn rewards!

Have you used ELMO3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies