ELOVL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82997

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ELOVL1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ELOVL1. Peptide sequence: RGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ELOVL1 Antibody - BSA Free

Western Blot: ELOVL1 Antibody [NBP2-82997]

Western Blot: ELOVL1 Antibody [NBP2-82997]

Western Blot: ELOVL1 Antibody [NBP2-82997] - Host: Rabbit. Target Name: ELOV1. Sample Type: Stomach Tumor lysates. Antibody Dilution: 1.0ug/ml

Applications for ELOVL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ELOVL1

Elongation of very long chain fatty acid-like (ELOVL) proteins 1-6 are members of the ELO family of proteins, which play an important role in tissue-specific biosynthesis of very long chain fatty acids and sphingolipids. The ELOVL proteins act as catalysts in fatty acid elongation reduction and localize to the endoplasmic reticulum (ER). Elongation of very long chain fatty acids protein 1 (ELOVL1), also referred to as Ssc1, is the human homolog of the yeast ELO3 protein. It is expressed in a variety of tissues and at especially high levels in stomach, skin, intestine, kidney and lung. ELOVL1 participates in the elongation of very long chain saturated and monounsaturated fatty acids of up to 26 carbons and may be required for the development of a barrier in epithelial cells and skin. ELOVL1 is also important for the formation of Myelin in the central nervous system. Impaired ELOVL1 activity may be associated with disorders of sphingolipid metabolism.

Alternate Names

EC 2.3.1.n8, elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 1, elongation of very long chain fatty acids protein 1, SSC1, Ssc1,3-keto acyl-CoA synthase ELOVL1

Gene Symbol

ELOVL1

Additional ELOVL1 Products

Product Documents for ELOVL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ELOVL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ELOVL1 Antibody - BSA Free

Customer Reviews for ELOVL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ELOVL1 Antibody - BSA Free and earn rewards!

Have you used ELOVL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies