ENPP-2/Autotaxin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58482

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ENPP-2/Autotaxin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ENPP-2/Autotaxin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ENPP-2/Autotaxin Antibody [NBP2-58482]

Immunocytochemistry/ Immunofluorescence: ENPP-2/Autotaxin Antibody [NBP2-58482]

Immunocytochemistry/Immunofluorescence: ENPP-2/Autotaxin Antibody [NBP2-58482] - Staining of human cell line BJ shows localization to nucleoplasm, the Golgi apparatus & actin filaments.

Applications for ENPP-2/Autotaxin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ENPP-2/Autotaxin

The protein encoded by the ENPP2 gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

Long Name

Ectonucleotide Pyrophosphatase/Phosphodiesterase 2

Alternate Names

ATX, Autotaxin, ENPP2, Lysophosphatidic Acid, NPP2, PDNP2

Gene Symbol

ENPP2

Additional ENPP-2/Autotaxin Products

Product Documents for ENPP-2/Autotaxin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ENPP-2/Autotaxin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Phosphatases and Regulators

Customer Reviews for ENPP-2/Autotaxin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ENPP-2/Autotaxin Antibody - BSA Free and earn rewards!

Have you used ENPP-2/Autotaxin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies