ENT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69313

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ENT2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC29A2(solute carrier family 29 (nucleoside transporters), member 2) The peptide sequence was selected from the C terminal of SLC29A2. Peptide sequence PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ENT2 Antibody - BSA Free

Western Blot: ENT2 Antibody [NBP1-69313]

Western Blot: ENT2 Antibody [NBP1-69313]

Western Blot: ENT2 Antibody [NBP1-69313] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: ENT2 Antibody [NBP1-69313]

Western Blot: ENT2 Antibody [NBP1-69313]

Western Blot: ENT2 Antibody [NBP1-69313] - This Anti-SLC29A2 antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.
Western Blot: ENT2 Antibody [NBP1-69313]

Western Blot: ENT2 Antibody [NBP1-69313]

Western Blot: ENT2 Antibody [NBP1-69313] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: ENT2 Antibody [NBP1-69313]

Western Blot: ENT2 Antibody [NBP1-69313]

Western Blot: ENT2 Antibody [NBP1-69313] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: ENT2 Antibody [NBP1-69313]

Western Blot: ENT2 Antibody [NBP1-69313]

Western Blot: ENT2 Antibody [NBP1-69313] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Applications for ENT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ENT2

SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.

Long Name

Equilibrative nucleoside transporter 2

Alternate Names

DER12, HNP36, SLC29A2

Gene Symbol

SLC29A2

UniProt

Q14542 (Human)

Additional ENT2 Products

Product Documents for ENT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ENT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ENT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ENT2 Antibody - BSA Free and earn rewards!

Have you used ENT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies