ERCC8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54898

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ERCC8 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ERCC8(excision repair cross-complementing rodent repair deficiency, complementation group 8) The peptide sequence was selected from the middle region of ERCC8. Peptide sequence FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ERCC8 Antibody - BSA Free

Western Blot: ERCC8 Antibody [NBP1-54898]

Western Blot: ERCC8 Antibody [NBP1-54898]

Western Blot: ERCC8 Antibody [NBP1-54898] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for ERCC8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ERCC8

ERCC8 is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). This gene encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptionally active genes.

Alternate Names

CKN1DNA excision repair protein ERCC-8, Cockayne syndrome 1 (classical), Cockayne syndrome WD repeat protein CSA, CSACockayne syndrome WD-repeat protein CSA, excision repair cross-complementing rodent repair deficiency, complementationgroup 8

Gene Symbol

ERCC8

UniProt

Q13216 (Human)

Additional ERCC8 Products

Product Documents for ERCC8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ERCC8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ERCC8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ERCC8 Antibody - BSA Free and earn rewards!

Have you used ERCC8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies