ETFDH Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84869

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ETFDH Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse ETFDH. Peptide sequence: EVLYHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKVTVFAEGCHGH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ETFDH Antibody - BSA Free

Western Blot: ETFDH Antibody [NBP2-84869]

Western Blot: ETFDH Antibody [NBP2-84869]

Western Blot: ETFDH Antibody [NBP2-84869] - Host: Rabbit. Target Name: Etfdh. Sample Type: Mouse Brain lysates. Antibody Dilution: 1.0ug/ml

Applications for ETFDH Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ETFDH

Electron-transferring-flavoprotein dehydrogenase in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane. The protein is synthesized as a 67-kDa precursor which is targeted to mitochondria and processed in a single step to a 64-kDa mature form located in the mitochondrial membrane. Deficiency in electron-transferring-flavoprotein dehydrogenase have been demonstrated in some patients with type II glutaricacidemia. [provided by RefSeq]

Alternate Names

electron-transferring-flavoprotein dehydrogenaseEC 1.5.5.1, ETFQO, ETF-QO, MADD, mitochondrial

Gene Symbol

ETFDH

Additional ETFDH Products

Product Documents for ETFDH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ETFDH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ETFDH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ETFDH Antibody - BSA Free and earn rewards!

Have you used ETFDH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies