FACL4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69303

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FACL4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ACSL4(acyl-CoA synthetase long-chain family member 4) The peptide sequence was selected from the N terminal of ACSL4. Peptide sequence AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FACL4 Antibody - BSA Free

Western Blot: FACL4 Antibody [NBP1-69303]

Western Blot: FACL4 Antibody [NBP1-69303]

Western Blot: FACL4 Antibody [NBP1-69303] - This Anti-ACSL4 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.

Applications for FACL4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FACL4

ACSL4 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants.

Alternate Names

ACS4mental retardation, X-linked 68, acyl-CoA synthetase 4, acyl-CoA synthetase long-chain family member 4, EC 6.2.1.3, FACL4long-chain 4, LACS 4, LACS4MRX68, lignoceroyl-CoA synthase, Long-chain acyl-CoA synthetase 4, long-chain fatty-acid-Coenzyme A ligase 4, long-chain-fatty-acid--CoA ligase 4, mental retardation, X-linked 63, MRX63

Gene Symbol

ACSL4

UniProt

O60488 (Human)

Additional FACL4 Products

Product Documents for FACL4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FACL4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FACL4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FACL4 Antibody - BSA Free and earn rewards!

Have you used FACL4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies