Factor VIII Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68934

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Factor VIII Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to F8 (coagulation factor VIII, procoagulant component) The peptide sequence was selected from the C terminal of F8. Peptide sequence IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Factor VIII Antibody - BSA Free

Western Blot: Factor VIII Antibody [NBP1-68934]

Western Blot: Factor VIII Antibody [NBP1-68934]

Western Blot: Factor VIII A2 domain Antibody [NBP1-68934] - Sample Tissue: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane, Gel Concentration: 0.12%
Western Blot: Factor VIII Antibody [NBP1-68934]

Western Blot: Factor VIII Antibody [NBP1-68934]

Western Blot: Factor VIII A2 domain Antibody [NBP1-68934] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for Factor VIII Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Factor VIII

Von Willebrand Factor (VWF) was previously known as Factor VIII related antigen. VWF is synthesized exclusively by endothelial cells and megakaryocytes, and stored in the intracellular granules or constitutively secreted into plasma. This glycoprotein functions as both an antihemophilic factor carrier and a platelet vessel wall mediator in the blood coagulation system. Important in the maintenance of homeostasis, it participates in platelet vessel wall interactions by forming a noncovalent complex with coagulation factor VIII at the site of vascular injury. The Von Willebrand factor has functional binding domains to platelet glycoprotein Ib, glycoprotein IIb/IIIa, collagen and heparin. Mutations in this gene or deficiencies in this protein result in Von Willebrand's disease. VWD is characterized by frequent bleeding (gingival, minor skin quantitative lacerations, menorrhagia, etc.).

Alternate Names

AHF, Antihemophilic factor, coagulation factor VIII, procoagulant component, coagulation factor VIIIc, DXS1253E, F8Ccoagulation factor VIII, factor VIII F8B, FVIII, HEMAF8B, Procoagulant component

Gene Symbol

F8

UniProt

P00451 (Human)

Additional Factor VIII Products

Product Documents for Factor VIII Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Factor VIII Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Factor VIII Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Factor VIII Antibody - BSA Free and earn rewards!

Have you used Factor VIII Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies