FBXW5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87437

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FBXW5. Peptide sequence: NDLTISLLHSADMRPYNWSYTQFSQFNKDDSLLLASGVFLGPHNSSSGEI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for FBXW5 Antibody - BSA Free

Western Blot: FBXW5 Antibody [NBP2-87437]

Western Blot: FBXW5 Antibody [NBP2-87437]

Western Blot: FBXW5 Antibody [NBP2-87437] - Host: Rabbit. Target Name: FBXW5. Sample Type: MDA-MB-435S Whole cell lysates. Antibody Dilution: 1.0ug/ml

Applications for FBXW5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FBXW5

The FBXW5 gene encodes a F-box/WD repeat-containing protein 5 that exists in two isoforms. Isoform 1 is 556 amino acids long, at nearly 64 kDA while isoform 2 is 377 amino acids long at 42 kDA. This protein encoded by this gene functions in substrate recognition of SCF as well as DCX E3 ubiquitin-protein ligase complexes. It may also work as a negative regulator of MAP3K7/TAK1 signaling in the interleukin-1B signaling pathway. FBXW5 participates in protein chaperonin-mediated protein folding and metabolism as well as the association of TriC/CCT with target proteins during biosynthesis. It is known to interact with genes CUL1, MDFI, SKP1, KRTAP4-12, and UBE2R2. FBXW5 is associated with tuberous sclerosis as well as hepatitis b.

Alternate Names

DKFZP434B205, F-box and WD repeat domain containing 5, F-box and WD-40 domain protein 5, F-box and WD-40 domain-containing protein 5, F-box/WD repeat-containing protein 5, FBW5, MGC20962, RP11-229P13.10, WD repeat-containing F-box protein FBW5

Gene Symbol

FBXW5

Additional FBXW5 Products

Product Documents for FBXW5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FBXW5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FBXW5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FBXW5 Antibody - BSA Free and earn rewards!

Have you used FBXW5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...