Fetuin A/AHSG Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-90302PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AHSG.

Source: E. coli

Amino Acid Sequence: GLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90302.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-90302PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Fetuin A/AHSG

Human fetuin (2-Heremans-Schmid-glycoprotein or a2-HS glycoprotein) is a major plasma glycoprotein predominantly synthesized in the liver. Human fetuin is named after its bovine homolog. Fetuins are found in most mammals. Human fetuin is a negative acute-phase protein; normal circulating levels in adults (300600 g/ml) fall significantly (3050%) during injury and infection. The biological role of fetuin is unknown, although it has been implicated as an immunomodulator that can participate in stimulation of bacterial phagocytosis by neutrophils and promotion of endocytosis by mouse macrophages. Hepatocytes are the principal cell source of circulating fetuin, but it also is expressed by monocyte/macrophages. Fetuins occur in large amounts in blood and cerebrospinal fluid and accumulate to high concentrations in calcified bone. The fetuin promoter region has several potential interleukin 6-responsive elements, and its synthesis is down-regulated during injury and inflammation. Fetuin is an acidic glycoprotein with three N-linked and three O-linked oligosaccharide chains, whose terminal sugar residues are rich in sialic acid (N-acetylneuraminic acid), contributing to its net negative charge. A role for fetuin as a carrier of bioactive molecules has been proposed based on observations that it binds and carries Ca2+ ion. Fetuin is implicated in bone remodeling, immune function and may play a role in tumor progression of certain cell types. Fetuin plays a role as an anti-inflammatory agent by suppressing the release of TNF from stimulated macrophages. Fetuin also interacts with members of the matrix metalloprotease family of zinc dependent secreted transmembrane proteins that degrade basement membranes and extracellular matrix components. The biological activity of fetuin is mediated through its direct interaction with other proteins. Fetuin down-regulates a number of receptor tyrosine kinase family members. A motif within fetuin has homology to the TGF-b receptor type II. Circulating human plasma fetuin is partly phosphorylated which implies that phosphorylated fetuin may have a physiological function in vivo. Human fetuin isolated from plasma is a two-chain molecule consisting of a A-chain of 322 amino acid residues (53 kDa) and a B-chain of 27 residues (5 kDa). The carboxy terminal 40 amino acids of the A chain constitute a bridging peptide that may be removed proteolytically in vivo. A single mRNA encodes both the A and B chains. The apparent molecular weight of intact human fetuin is 58 kDa.

Long Name

alpha-2-HS Glycoprotein

Alternate Names

AHSG, alpha-2-HS-glycoprotein

Gene Symbol

AHSG

Additional Fetuin A/AHSG Products

Product Documents for Fetuin A/AHSG Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fetuin A/AHSG Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Fetuin A/AHSG Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Fetuin A/AHSG Recombinant Protein Antigen and earn rewards!

Have you used Fetuin A/AHSG Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...