FGF14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84933

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FGF14 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FGF14. Peptide sequence: AIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for FGF14 Antibody - BSA Free

Western Blot: FGF14 Antibody [NBP2-84933]

Western Blot: FGF14 Antibody [NBP2-84933]

Western Blot: FGF14 Antibody [NBP2-84933] - Host: Rabbit. Target Name: FGF14. Sample Tissue: NCI-H226 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for FGF14 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FGF14

The FGF14 gene codes for a fibroblast growth factor 14 protein that in isoform 1 is 247 amino acids long at 27 kDA and in isoform 2 is 252 amino acids long at 28 kDA. This gene is a member of the fibroblast growth factor (FGF) family so is thought to participate in nervous system development and function. FGF14 is involved in regulation of actin cytoskeleton, MAPK signaling, mitochondrial apoptosis, paxillin pathways, and nuclear receptor activation by vitamin-A. It interacts with genes EGFR, FGFR1, FGFR2, FGFR3, and FGFR4. FGF14 is associated with pancreatitis, gingivitis, breast cancer, ladd syndrome, ataxia, cerebritis, retinitis, neuronitis, and adenocarcinoma.

Alternate Names

bA397O8.2, FGF-14, FHF4FHF-4, fibroblast growth factor 14, Fibroblast growth factor homologous factor 4, SCA27MGC119129

Gene Symbol

FGF14

Additional FGF14 Products

Product Documents for FGF14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FGF14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FGF14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FGF14 Antibody - BSA Free and earn rewards!

Have you used FGF14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies