FHOD1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-83900
![Immunocytochemistry/ Immunofluorescence: FHOD1 Antibody [NBP1-83900]](https://resources.rndsystems.com/images/products/FHOD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83900-img0004.jpg "Immunocytochemistry/ Immunofluorescence: FHOD1 Antibody [NBP1-83900]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AMPNEAGGHPDARQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNVESVEAGKDIPAPSPPLPLLSGVP
Reactivity Notes
Reactivity reported in scientific literature (PMID: 24086398)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for FHOD1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: FHOD1 Antibody [NBP1-83900]
Immunocytochemistry/Immunofluorescence: FHOD1 Antibody [NBP1-83900] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900]](https://resources.rndsystems.com/images/products/FHOD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83900-img0008.jpg "Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900]")
Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900]
Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.![Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900]](https://resources.rndsystems.com/images/products/FHOD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83900-img0005.jpg "Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900]")
Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900]
Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human cerebellum shows no cytoplasmic positivity in Purkinje cells as expected.![Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900]](https://resources.rndsystems.com/images/products/FHOD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83900-img0006.jpg "Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900]")
Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900]
Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.![Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900]](https://resources.rndsystems.com/images/products/FHOD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83900-img0007.jpg "Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900]")
Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900]
Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.Applications for FHOD1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature ( PMID 24062339).
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: FHOD1
Alternate Names
FH1/FH2 domain-containing protein 1, FHOS1, FHOSFormin homolog overexpressed in spleen 1, formin homology 2 domain containing 1, Formin homology 2 domain-containing protein 1
Gene Symbol
FHOD1
Additional FHOD1 Products
Product Documents for FHOD1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for FHOD1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for FHOD1 Antibody - BSA Free
Powered by Bioz
Customer Reviews for FHOD1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review FHOD1 Antibody - BSA Free and earn rewards!
Have you used FHOD1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for FHOD1 Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: I have purchased the anti FHOD1 antibody, catalog number NBP1-83900, Lot R11876, and I would like to know the concentration since it is not specified in the vial. Also it would be helpful if you can recommend cell lines for which IF detection of FHOD1 with this antibody is specially good.
A: The concentration for NBP1-83900 Lot R11876 is 0.05 mg/ml. In our lab, for immunofluorescent staining of human cells, this antibody was tested in A-431 cell line wherein it showed positivity in the cytoplasm. Besides A-431, FHOD1 is highly expressed in A-549, HEK 293, HeLa and U-2 OS; and you may consider any of these cell lines as a positive control.
Loading...