Fibronectin Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-84468PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FN1.

Source: E. coli

Amino Acid Sequence: HEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84468.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-84468PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Fibronectin

Fibronectin (also known as FN1, or Fibronectin 1) is an extracellular matrix glycoprotein that binds to integrins and has a large role in cell adhesion, migration, differentiation, and growth. It plays a key role in wound healing by helping form blood clots and participates in embryonic development by guiding cell attachment and migration. Fibronectin consists of two monomers linked by disulfide bonds and binds extracellular components such as collagen fibrin and syndecans. Fibronectin has been implicated in carcinoma and tumor development while also limiting tumor cells response to treatment. Novus offers Fibronectin antibodies, ELISA Kits, lysates, and proteins

Alternate Names

CIG, ED-B, FINC, FN1, FNZ, GFND2, LETS, SMDCF

Gene Symbol

FN1

Additional Fibronectin Products

Product Documents for Fibronectin Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fibronectin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Fibronectin Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Fibronectin Recombinant Protein Antigen and earn rewards!

Have you used Fibronectin Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Fibronectin Recombinant Protein Antigen

Showing  1 - 1 of 1 FAQ Showing All
  • Q: What is the difference between Bovine Fibronectin Protein, CF (Catalog # 1030-FN) and Human Fibronectin Protein, CF (Catalog # 1918-FN)?

    A: Only the source species for the protein is different. Both carrier-free proteins have been validated to be bioactive with the same assay protocols listed and recommended concentrations fall within the same range, although customers should determine their optimal concentrations for their particular cell type and application. 

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes