Forkhead box I2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09208

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_899016). Peptide sequence AQAGGELDMAGFCDSLGSCSVPHGLTRAIAHPPSYGRTDLSSGRRLWVNS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Forkhead box I2 Antibody - BSA Free

Western Blot: Forkhead box I2 Antibody [NBP3-09208]

Western Blot: Forkhead box I2 Antibody [NBP3-09208]

Western Blot: Forkhead box I2 Antibody [NBP3-09208] - Western blot analysis of Forkhead box I2 in Mouse Brain as a positive control. Antibody dilution at 0.2-1 ug/ml

Applications for Forkhead box I2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Forkhead box I2

Forkhead box I2 is one of a range of Investigative Grade antibodies, made against targets that have limited or no commercial antibodies available to them and for which there are no data on the expression of the protein in the range of common cell lines and tissues available to us. These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot. However no additional claims are made for their ability to recognise native protein in any application.

Alternate Names

FLJ46831, forkhead box I2, forkhead box protein I2, homolog of mouse Foxi2

Gene Symbol

FOXI2

Additional Forkhead box I2 Products

Product Documents for Forkhead box I2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Forkhead box I2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Forkhead box I2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Forkhead box I2 Antibody - BSA Free and earn rewards!

Have you used Forkhead box I2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...