FXYD6 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04818

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human FXYD6 (NP_071286.1). MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FXYD6 Antibody - Azide and BSA Free

Western Blot: FXYD6 AntibodyAzide and BSA Free [NBP3-04818]

Western Blot: FXYD6 AntibodyAzide and BSA Free [NBP3-04818]

Western Blot: FXYD6 Antibody [NBP3-04818] - Analysis of extracts of various cell lines, using FxYD6 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Applications for FXYD6 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: FXYD6

This reference sequence was derived from multiple replicate ESTs and validated by human genomic sequence. This geneencodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain,beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved humangene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD2, also known as the gammasubunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3(MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems.Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminusextracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD6, is novel and hasnot been characterized as a protein. Multiple alternatively spliced transcript variants that encode the same proteinisoform have been described. RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu.)

Alternate Names

FXYD domain containing ion transport regulator 6, FXYD domain-containing ion transport regulator 6, phosphohippolin

Gene Symbol

FXYD6

Additional FXYD6 Products

Product Documents for FXYD6 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FXYD6 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for FXYD6 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review FXYD6 Antibody - Azide and BSA Free and earn rewards!

Have you used FXYD6 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...