G6PC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82857

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human G6PC3. Peptide sequence: ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for G6PC3 Antibody - BSA Free

Western Blot: G6PC3 Antibody [NBP2-82857]

Western Blot: G6PC3 Antibody [NBP2-82857]

Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target Name: G6PC3. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: G6PC3 Antibody [NBP2-82857]

Western Blot: G6PC3 Antibody [NBP2-82857]

Western Blot: G6PC3 Antibody [NBP2-82857] - WB Suggested Anti-G6PC3 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellG6PC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Western Blot: G6PC3 Antibody [NBP2-82857]

Western Blot: G6PC3 Antibody [NBP2-82857]

Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target Name: G6PC3. Sample Type: Hela. Antibody Dilution: 1.0ug/mlG6PC3 is strongly supported by BioGPS gene expression data to be expressed in HeLa
Western Blot: G6PC3 Antibody [NBP2-82857]

Western Blot: G6PC3 Antibody [NBP2-82857]

Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target Name: G6PC3. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml
Western Blot: G6PC3 Antibody [NBP2-82857]

Western Blot: G6PC3 Antibody [NBP2-82857]

Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target Name: G6PC3. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: G6PC3 Antibody [NBP2-82857]

Western Blot: G6PC3 Antibody [NBP2-82857]

Western Blot: G6PC3 Antibody [NBP2-82857] - Host: Rabbit. Target: G6PC3. Positive control (+): MCF7 (N10). Negative control (-): Human Placenta (PL). Antibody concentration: 1ug/ml

Applications for G6PC3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: G6PC3

Glucose-6-phosphatase (G6Pase) is located in the endoplasmic reticulum (ER) and catalyzes hydrolysis of G6P to glucose and phosphate, the last step of the gluconeogenic and glycogenolytic pathways. G6PC3 is a ubiquitously expressed G6Pase catalytic subunit (Martin et al., 2002 [PubMed 12370122]; Guionie et al., 2003 [PubMed 12965222]).[supplied by OMIM]

Alternate Names

EC 3.1.3.9, G6Pase 3, G-6-Pase 3, G6Pase-beta, glucose 6 phosphatase, catalytic, 3, glucose-6-phosphatase 3, Glucose-6-phosphatase beta, glucose-6-phosphatase catalytic subunit 3, Ubiquitous glucose-6-phosphatase catalytic subunit-related protein, ubiquitously expressed G6Pase catalytic subunit-related protein, UGRPSCN4

Gene Symbol

G6PC3

Additional G6PC3 Products

Product Documents for G6PC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for G6PC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for G6PC3 Antibody - BSA Free

Customer Reviews for G6PC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review G6PC3 Antibody - BSA Free and earn rewards!

Have you used G6PC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...