Galectin-4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91560

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Galectin-4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human Lgals4. Peptide sequence VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Galectin-4 Antibody - BSA Free

Western Blot: Galectin-4 Antibody [NBP1-91560]

Western Blot: Galectin-4 Antibody [NBP1-91560]

Western Blot: Galectin-4 Antibody [NBP1-91560] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Brain.

Applications for Galectin-4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Galectin-4

Galectins are a family of soluble beta-galactoside-binding animal lectins that modulate cell-to-cell adhesion and cell-to-extracellular matrix (ECM) interactions and play a role in tumor progression, pre-mRNA splicing and apoptosis. One member of this family, Galectin-4, also known as Gal-4, L36 or LGALS4 maps to human chromosome 19q13.13 and encodes a 36-37 kDa protein. The Galectin-4 protein is composed of 323 amino acids and contains two homologous carbohydrate recognition domains (CRD) and all amino acids typically conserved in the galectin family. Expression of Galectin-4 correlates with the malignant potential of human hepatocellular carcinoma (HCC) and is differentially regulated depending on cell-cell contact, serum growth factors, cell growth and cell differentiation status. Galectin-4 expression is detected in epithelial cells of the colon, rectum, intestine, and in HT29 and LS174T cell lines. Galectin-4 is underexpressed in colorectal cancer and is preferentially upregulated in cells prone to peritoneal dissemination.

Alternate Names

GAL4, Galectin4, LGALS4

Gene Symbol

LGALS4

UniProt

NP_034836 (Mouse)

Additional Galectin-4 Products

Product Documents for Galectin-4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Galectin-4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Lectins
NKG2D Receptors and Ligands

Customer Reviews for Galectin-4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Galectin-4 Antibody - BSA Free and earn rewards!

Have you used Galectin-4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies