GALNT12 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-24860PEP

Novus Biologicals
100% Guarantee

Key Product Details

Applications

Antibody Competition
View all Polypeptide GalNAc Transferase 12/GALNT12 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GALNT12

Source: E.coli

Amino Acid Sequence: VPEDRPGFFGMLQNKGLTDYCFDYNPPDENQIVGHQVILYLCHGMGQNQFF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24860It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-24860PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Polypeptide GalNAc Transferase 12/GALNT12

GALNT12, also known as Polypeptide N-acetylgalactosaminyltransferase 12, has a 581 amino acid long isoform that is 67 kDa and a short 272 amino acid isoform that is 32 kDa, plays role in catalyzing the initial reaction in O-linked oligosaccharide biosynthesis, and the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor; displays activity toward non-glycosylated peptides such as Muc5AC, Muc1a and EA2, Gal-NAc-Muc5AC glycopeptide; and initializes mucin-type oligosaccharide biosynthesis in digestive organs. Studies on this protein have shown a relationship with the following disorders and diseases: colorectal cancer, colon cancer, cerebritis, thyroiditis, and prostatitis. This protein has also been shown to have interactions with MUC7, MUC1, MUC2, MUC5AC, and C1GALT1 in the pathways such as the O-linked glycosylation of mucins, metabolism of proteins, post-translational protein modification, and mucin type O-Glycan biosynthesis.

Long Name

UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 12

Alternate Names

CRCS1, GalNAc-T12, Pp-GaNTase 12

Gene Symbol

GALNT12

Additional Polypeptide GalNAc Transferase 12/GALNT12 Products

Product Documents for GALNT12 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GALNT12 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for GALNT12 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review GALNT12 Recombinant Protein Antigen and earn rewards!

Have you used GALNT12 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes