GCFC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09369

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GCFC2 (NP_003194). Peptide sequence SEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQ

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GCFC2 Antibody - BSA Free

Western Blot: GCFC2 Antibody [NBP3-09369]

Western Blot: GCFC2 Antibody [NBP3-09369]

Western Blot: GCFC2 Antibody [NBP3-09369] - Western blot analysis using NBP3-09369 on Human Lung as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for GCFC2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GCFC2

The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene. [provided by RefSeq]

Alternate Names

C2orf3, chromosome 2 open reading frame 3, DNABF, GC bindng factor, GCF, GCFGC binding factor, GC-rich sequence DNA-binding factor, GC-rich sequence DNA-binding factor 2, TCF9, TCF-9, Transcription factor 9, transcription factor 9 (binds GC-rich sequences)

Gene Symbol

GCFC2

Additional GCFC2 Products

Product Documents for GCFC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GCFC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GCFC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GCFC2 Antibody - BSA Free and earn rewards!

Have you used GCFC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...