GHRH Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86651

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GHRH. Peptide sequence: LSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GHRH Antibody - BSA Free

Western Blot: GHRH Antibody [NBP2-86651]

Western Blot: GHRH Antibody [NBP2-86651]

Western Blot: GHRH Antibody [NBP2-86651] - Host: Rabbit. Target Name: GHRH. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for GHRH Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GHRH

GHRH, also known as Somatoliberin or Growth hormone-releasing hormone, has a 108 amino acid isoform and a 107 amino acid isoform that are 12 kDa, is produced by the hypothalamus and its main function is to stimulate growth hormone release. Disease research is being performed on this proteins involvement in gigantism, isolated growth hormone deficiency due to defect in ghrf, dwarfism, gigantism due to ghrf hypersecretion, zollinger-ellison syndrome, anorexia, nervosa, multiple endocrine neoplasia, polycystic ovary syndrome, short stature, Cushing's syndrome, hypopituitarism, diabetes insipidus, panic disorder, hypothyroidism, somatostatinoma, acromegaly, vipoma, pituitary adenoma, Prader-Willi syndrome, hyperprolactinemia, cancer, lipodystrophy, hypogonadism, diabetes mellitus, and Pseudohypoparathyroidism. This protein has been involved in 55 different pathways such as nuclear receptor activation by vitamin-A, Paxillin Interactions, telomerase components in cell signaling, mitochondrial apoptosis, molecular mechanisms of cancer, antioxidant action of vitamin-C, eIF2 pathway, intracellular calcium signaling, JNK pathway, apoptotic pathways in synovial fibroblasts, ERK5 signaling, Tec kinases signaling, GSK3 signaling, and cellular apoptosis pathway where it interacts with GHRHR, DPP4, FAP, ADCYAP1R1, POMC, NPS, MC4R, ADRB1, and 50 other proteins.

Alternate Names

GHRFsomatocrinin, GRF, growth hormone releasing hormone, Growth hormone-releasing factor, Growth hormone-releasing hormone, INN, MGC119781, sermorelin, Somatocrinin, somatoliberin, somatorelin

Gene Symbol

GHRH

Additional GHRH Products

Product Documents for GHRH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GHRH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GHRH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GHRH Antibody - BSA Free and earn rewards!

Have you used GHRH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...