GHRHR Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82231

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GHRHR Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GHRHR. Peptide sequence: PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GHRHR Antibody - BSA Free

Western Blot: GHRHR Antibody [NBP2-82231]

Western Blot: GHRHR Antibody [NBP2-82231]

Western Blot: GHRHR Antibody [NBP2-82231] - WB Suggested Anti-GHRHR Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: PANC1 cell lysateGHRHR is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells

Applications for GHRHR Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GHRHR

GHRHR belongs to the glucagon family and is produced in the hypothalamus as a preproprotein. The preproprotein is cleaved to form a 44 aa factor, also called somatocrinin, that acts to stimulate growth hormone release from the pituitary. Variant receptors for somatocrinin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this gene are a cause of dwarfism, while hypersecretion of the encoded protein is a cause of gigantism.

Long Name

Growth Hormone Releasing Hormone Receptor

Alternate Names

GHRFR, GRFR, IGHD1B, Little

Gene Symbol

GHRHR

Additional GHRHR Products

Product Documents for GHRHR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GHRHR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GHRHR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GHRHR Antibody - BSA Free and earn rewards!

Have you used GHRHR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies