GJD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84046

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GJD3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of GJD3. Peptide sequence: GLLSALLSVAELGHLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GJD3 Antibody - BSA Free

Western Blot: GJD3 Antibody [NBP2-84046]

Western Blot: GJD3 Antibody [NBP2-84046]

Western Blot: GJD3 Antibody [NBP2-84046] - WB Suggested Anti-GJD3 Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell

Applications for GJD3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GJD3

The GJD3 gene is a member of the large family of connexins that are required for the formation of gap junctions. Sixconnexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexonfrom a neighboring cell, thus

Alternate Names

Connexin-31.9, Cx30.2, Cx31.9, CX31.9connexin-31.9, Gap junction alpha-11 protein, Gap junction chi-1 protein, gap junction protein, chi 1, 31.9kDa, gap junction protein, delta 3, 31.9kDa, GJA11connexin 31.9, GJC1gap junction delta-3 protein

Gene Symbol

GJD3

Additional GJD3 Products

Product Documents for GJD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GJD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GJD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GJD3 Antibody - BSA Free and earn rewards!

Have you used GJD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies