Catalog Number: 2258
Alternate Names: Glucagon-like peptide 2 (human)
Biological Activity
Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.
Technical Data
  • M.Wt:
    3766.14
  • Formula:
    C165H254N44O55S
  • Sequence:
    HADGSFSDEMNTILDNLAARDFINWLIQTKITD
  • Solubility:
    Soluble to 1 mg/ml in 5% NH4OH / water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    223460-79-5
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Additional Information
Other Product-Specific Information:
Background References
  1. Glucagon-like peptide-2: divergent signalling pathways.
    Rocha et al.
    J.Surg.Res., 2004;121:5
  2. Glucagon-like peptides regulate cell proliferation and apoptosis in the pancreas, gut, and central nervous system.
    Brubaker and Drucker
    Endocrinol., 2004;145:2653
Citations:

The citations listed below are publications that use Tocris products. Selected citations for GLP-2 (human) include:

1 Citations: Showing 1 - 1

  1. Glucagon-like peptide-2 modulates neurally evoked mucosal chloride secretion in guinea pig small intestine in vitro.
    Authors: Baldassano Et al.
    Am J Physiol Gastrointest Liver Physiol 2009;297:G800

Have you used GLP-2 (human)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information