GNB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55323

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GNB2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GNB2(guanine nucleotide binding protein (G protein), beta polypeptide 2) The peptide sequence was selected from the middle region of GNB2. Peptide sequence CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: beta-2.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GNB2 Antibody - BSA Free

Western Blot: GNB2 Antibody [NBP1-55323]

Western Blot: GNB2 Antibody [NBP1-55323]

Western Blot: GNB2 Antibody [NBP1-55323] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for GNB2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GNB2

Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB2 is a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5' UTR. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

beta-2 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 2, guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2, guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2, signal-transducing guanine nucleotide-binding regulatory protein beta subunit

Gene Symbol

GNB2

UniProt

P62879 (Human)

Additional GNB2 Products

Product Documents for GNB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GNB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GNB2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GNB2 Antibody - BSA Free and earn rewards!

Have you used GNB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies