GNPDA1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04769

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human GNPDA1 (NP_005462.1). MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GNPDA1 Antibody - Azide and BSA Free

Western Blot: GNPDA1 AntibodyAzide and BSA Free [NBP3-04769]

Western Blot: GNPDA1 AntibodyAzide and BSA Free [NBP3-04769]

Western Blot: GNPDA1 Antibody [NBP3-04769] - Analysis of extracts of various cell lines, using GNPDA1 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Applications for GNPDA1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GNPDA1

GNPDA1, also known as Glucosamine-6-phosphate isomerase 1, is a 289 amino acid that is 33 kDa, with homohexamer subunit structure and cytoplasm location; is an allosteric enzyme that catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium; and appears to trigger calcium oscillations in mammalian eggs which operate as the basic trigger for egg activation and early development of the embryo. Disease research is currently being studied with relation to GNPDA1 and lipoid nephrosis, hepatocellular carcinoma, and acute interstitial pneumonia. The protein has been linked to the amino sugar and nucleotide sugar metabolism and metabolic pathways where it interacts with MCC, EWSR1, ILF2, AMDHD2, and GP1.

Alternate Names

EC 3.5.99.6, GlcN6P deaminase 1, glucosamine-6-phosphate deaminase 1KIAA0060HLNGNPIGNPDA, glucosamine-6-phosphate isomerase, glucosamine-6-phosphate isomerase 1, GNP1, GNPDA 1, GPI, oscillin

Gene Symbol

GNPDA1

Additional GNPDA1 Products

Product Documents for GNPDA1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GNPDA1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for GNPDA1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GNPDA1 Antibody - Azide and BSA Free and earn rewards!

Have you used GNPDA1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...