GPR108 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56970

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GPR108 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GPR108 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GPR108 Antibody [NBP2-56970]

Immunocytochemistry/ Immunofluorescence: GPR108 Antibody [NBP2-56970]

Immunocytochemistry/Immunofluorescence: GPR108 Antibody [NBP2-56970] - HeLa cells fixed in 4% PFA, permeablised with TRITON X-100 and stained with anti-GPR108 and an AlexaFluor 546 conjugated secondary antibody. Image from verified customer review.
Immunocytochemistry/ Immunofluorescence: GPR108 Antibody [NBP2-56970]

Immunocytochemistry/ Immunofluorescence: GPR108 Antibody [NBP2-56970]

Immunocytochemistry/Immunofluorescence: GPR108 Antibody [NBP2-56970] - Staining of human cell line SiHa shows localization to the Golgi apparatus. Antibody staining is shown in green.

Applications for GPR108 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP2-56970 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPR108

LUSTR2 is an Orphan-U GPCR with an unknown ligand.

Long Name

G Protein-coupled Receptor 108

Alternate Names

LUSTR2

Gene Symbol

GPR108

Additional GPR108 Products

Product Documents for GPR108 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GPR108 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GPR108 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used GPR108 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • GPR108 Antibody
    Name: Charlotte Ford
    Application: Western blot and immunofluorescence
    Sample Tested: hela cell and Hela whole cell lysate
    Species: Human
    Verified Customer | Posted 12/15/2022
    WB HeLa cells treated with control or GPR108 siRNA blotted with anti- GPR108 or anti-beta-actin. IF field of HeLa cells fixed in 4% PFA, permeablised with TRITON X-100 and stained with anti-GPR108 and an AlexaFluor 546 conjugated secondary antibody.
    GPR108 Antibody - BSA Free NBP2-56970
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs for GPR108 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I was wondering if GPR108 (NBP2-56970) had an intracellular or extracellular target?

    A: This GPR108 antibody is against the C-terminus (aa 497-543). However, it has not been specified whether this region is located in the extra or intracellular domain uniprot.org/uniprot/Q9NPR9.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies