GSAP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82245

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GSAP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSAP. Peptide sequence: QTRQNELLYTFEKDLQVFSCSVNSERTLLAASLVQSTKEGKRNELQPGSK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GSAP Antibody - BSA Free

Western Blot: GSAP Antibody [NBP2-82245]

Western Blot: GSAP Antibody [NBP2-82245]

Western Blot: GSAP Antibody [NBP2-82245] - Host: Rabbit. Target Name: GSAP. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for GSAP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GSAP

Gamma secretase activating protein (GSAP) is implicated in Alzheimer's disease, through instigating plaque formation of amyloid beta. Immunohistochemistry to identify GSAP in brain can demonstrate its abundance in certain regions of damage, and is usually morphologically changed throughout the progression of Alzheimer's disease. GSAP can be used as a qualitative biomarker of Alzheimer's disease progression, and is regularly considered one of the best targets of therapies to diminish the effects of Alzheimer's disease in affected individuals.

Long Name

Gamma-Secretase Activating Protein

Alternate Names

PION, tcag7.1314

Gene Symbol

PION

Additional GSAP Products

Product Documents for GSAP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GSAP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Aspartic Proteases and Regulators

Customer Reviews for GSAP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GSAP Antibody - BSA Free and earn rewards!

Have you used GSAP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies