GTF2A1L Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69205

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GTF2A1L Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GTF2A1L (general transcription factor IIA, 1-like) The peptide sequence was selected from the C terminal of GTF2A1L. Peptide sequence EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GTF2A1L Antibody - BSA Free

Western Blot: GTF2A1L Antibody [NBP1-69205]

Western Blot: GTF2A1L Antibody [NBP1-69205]

Western Blot: GTF2A1L Antibody [NBP1-69205] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Applications for GTF2A1L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GTF2A1L

The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.

Alternate Names

1-like factor, general transcription factor IIA, 1-like, GTF2A1LF, MGC26254, TFIIA large subunit isoform ALF, TFIIA-alpha and beta-like factor, TFIIA-alpha/beta-like factor

Gene Symbol

GTF2A1L

Additional GTF2A1L Products

Product Documents for GTF2A1L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GTF2A1L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GTF2A1L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GTF2A1L Antibody - BSA Free and earn rewards!

Have you used GTF2A1L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies