Guangxitoxin 1E

Catalog # Availability Size / Price Qty
5676/100U
Guangxitoxin 1E
1 Image
Description: Potent Kv2.1 and Kv2.2 channel blocker

Purity: ≥95%

Product Details
Citations (1)
Reviews

Biological Activity

Guangxitoxin 1E is a Kv2.1 and Kv2.2 channel blocker (IC50 values are 1-3 nM). Enhances glucose-stimulated insulin secretion from human islets in vitro, but not from islet cells lacking the Kv2.1 channel. Has no significant effect on plasma insulin, glucagon or blood glucose levels in mice, but increases plasma somatostatin levels.

Technical Data

M.Wt:
3948.61
Formula:
C178H248N44O45S7
Sequence:
EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP

(Modifications: Disulfide bridges: 4-19, 11-24, 18-31)

Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
1233152-82-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citation for Guangxitoxin 1E

The citations listed below are publications that use Tocris products. Selected citations for Guangxitoxin 1E include:

1 Citation: Showing 1 - 1

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Guangxitoxin 1E

There are currently no reviews for this product. Be the first to review Guangxitoxin 1E and earn rewards!

Have you used Guangxitoxin 1E?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.