Guangxitoxin 1E

Catalog # Availability Size / Price Qty
5676/100U
Voltage-gated Potassium Channel Blockers Peptide
1 Image
Description: Potent Kv2.1 and Kv2.2 channel blocker
Product Details
Reviews (1)

Biological Activity

K v 2.1 and K v 2.2 channel blocker (IC 50 values are 1-3 nM). Enhances glucose-stimulated insulin secretion from human islets in vitro, but not from islet cells lacking the K v 2.1 channel. Has no significant effect on plasma insulin, glucagon or blood glucose levels in mice, but increases plasma somatostatin levels.

Technical Data

M.Wt:
3948.61
Formula:
C178H248N44O45S7
Sequence:
EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP

(Modifications: Disulfide bridge: 4-19,11-24,18-31)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
1233152-82-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Guangxitoxin 1E

Average Rating: 5 (Based on 1 Review)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used Guangxitoxin 1E?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


Use of Guangxitoxin 1E in several BK channel studies
By Anonymous on 01/31/2019
Species: Human

Our lab has used Guangxitoxin 1E in several BK channel studies over the last few years. Our results have always been reliable and reproducible. We will surely continue using this product.


Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.