H2AFJ Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09542

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human H2AFJ (NP_808760). Peptide sequence AKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for H2AFJ Antibody - BSA Free

Western Blot: H2AFJ Antibody [NBP3-09542]

Western Blot: H2AFJ Antibody [NBP3-09542]

Western Blot: H2AFJ Antibody [NBP3-09542] - Western blot analysis of H2AFJ in RPMI-8226 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for H2AFJ Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: H2AFJ

Histones are nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber as they play a critical role in transcription regulation, DNA repair, DNA replication, and chromosomal stability. The H2AFJ gene is located on chromosome 12 encodes a histone H2A.J protein that exists in two isoforms: isoform 1 is 129 amino acids long at 14 kDA while isoform 2 is 151 amino acids long at 16 kDA. The protein is divergent at the C-terminus compared to the consensus H2A histone family member. The H2AFJ gene has been researched regarding lupus, nevus, and immunodeficiency and is known to interact with various genes such as H3F3B, CENPA, ASXL2, KIAA1609, and RBBP4.

Alternate Names

FLJ10903, FLJ52230, H2A histone family, member J, H2a/j, H2AJ, histone H2A.J, MGC921

Gene Symbol

H2AJ

Additional H2AFJ Products

Product Documents for H2AFJ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for H2AFJ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for H2AFJ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review H2AFJ Antibody - BSA Free and earn rewards!

Have you used H2AFJ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...