H2AFV Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84057

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human H2AFV. Peptide sequence: MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGAT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for H2AFV Antibody - BSA Free

Western Blot: H2AFV Antibody [NBP2-84057]

Western Blot: H2AFV Antibody [NBP2-84057]

Western Blot: H2AFV Antibody [NBP2-84057] - Host: Rabbit. Target Name: H2AFV. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that H2AFV is expressed in HEK293T

Applications for H2AFV Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: H2AFV

H2AFV is 128 amino acids long, weighs approximately 13.5 kDa, and the gene codes for a variant component that is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. H2AFV has three shorter isoforms that are 114, 90, and 102 amino acids long, weighing 12, 9, and 11 kDa respectively. Current studies are being done on several diseases and disorders including systemic lupus erythematosus, lupus erythematosus, malaria, ataxia telangiectasia, intrahepatic cholangiocarcinoma, pharyngitis, and immunodeficiency. H2AFV has also been shown to have interactions with MORF4L1, MRGBP, PAX9, CAMSAP2, and ATG4C in pathways such as the systemic lupus erythematosus pathways.

Alternate Names

FLJ26479, H2A histone family, member V, H2A.F/Z, H2AV, histone H2A.F/Z, histone H2A.V, MGC10170, MGC10831, MGC1947, purine-rich binding element protein B

Gene Symbol

H2AZ2

Additional H2AFV Products

Product Documents for H2AFV Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for H2AFV Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for H2AFV Antibody - BSA Free

There are currently no reviews for this product. Be the first to review H2AFV Antibody - BSA Free and earn rewards!

Have you used H2AFV Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...